PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004231.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 224aa    MW: 26041.4 Da    PI: 10.2555
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004231.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK57.13.6e-1860108452
                   RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              +is  +ls yF++pi +AAkeL v   +LK +C ++GI RWPhR++ sl
  Itr_sc004231.1_g00004.1  60 TISKAMLSTYFHMPIYKAAKELRVEYRILKTRCEELGIFRWPHRQLVSL 108
                              79999****************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.11841130IPR003035RWP-RK domain
PfamPF020421.2E-1560108IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MDGVLLPSAS VIPIEWDITP TSNAVAVKQD TTTGTKESMI EKIVRRQSKR TKITFRDPST  60
ISKAMLSTYF HMPIYKAAKE LRVEYRILKT RCEELGIFRW PHRQLVSLQK LFENVKELGS  120
IEDDPELREV LKEIKDRREM MLRNPHLKLH PAEIKLRDAC TRKKSCVERK LQLHGTEAIH  180
PFNTTAYSLG HILLIAPRQM EVFRNHFKIP KSFGWSGIIP YNYG
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-24RWP-RK domain-containing protein